All products are intended solely for collector's purposes!
It is NOT possible to use chemical substances as medicine, medicine, active substance, medical aid, cosmetic product, substance for the production of a cosmetic product...
Also not as a substance for human consumption, ie as a food or nutritional supplement or in any other similar way on humans or animals.
18+ All customers MUST be at least 18 years of age to purchase our products.

EGF – 650mcg

299.00

3 Products -5%
284.05 € /pc
6 Products -10%
269.10 € /pc
8 Products -15%
254.15 € /pc

EGF 650 mcg
research-grade
lyophilized protein powder
supplied in a glass vial. Epidermal growth factor (EGF) is a signaling protein commonly studied in laboratory models involving EGFR activation, intracellular signaling, cellular proliferation, migration and differentiation.

Research Use Only:
All products are intended exclusively for laboratory and scientific research. Not for human or veterinary use.

Purity
Batch-specific; refer to the Certificate of Analysis (CoA)

Form
Lyophilized protein powder

Content
650 mcg EGF per vial

Packaging
Glass vial with sterile closure

Storage
Store lyophilized at −20 °C (desiccated, protect from light)

Molecular formula

C₂₇₀ H₄₀₁ N₇₃ O₈₃ S₇

Molecular weight
~6,222 g·mol⁻¹ (6.22 kDa)

Sequence
Mature human epidermal growth factor consisting of 53 amino acids and containing three intramolecular disulfide bonds.
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

CAS number
62253-63-8


Laboratory handling conditions should follow the product-specific Certificate of Analysis and validated experimental protocol.

Select the appropriate sterile research diluent according to the requirements of the intended in vitro or laboratory workflow.

Research Overview

Epidermal growth factor is a signaling protein studied primarily for its interaction with the epidermal growth factor receptor (EGFR). Binding of EGF to EGFR is used in laboratory models to investigate receptor activation, intracellular signal transduction and subsequent changes in cellular behavior.

Primary Research Areas

  • EGFR signaling:
    Laboratory studies examining receptor binding, receptor phosphorylation and downstream signaling pathways activated following EGF stimulation.
  • Cell proliferation:
    Experimental models investigating growth-factor-dependent cell-cycle activity and cellular proliferation responses.
  • Cell migration:
    In vitro research examining cellular movement, wound-closure models and signaling mechanisms associated with migration.
  • Cell differentiation:
    Research into changes in cellular phenotype, morphology and function following EGFR pathway activation.
Reconstitution

Recommended solvent — Bacteriostatic water

Bacteriostatic water 10ml

For diluting lyophilized peptide powders, use a sterile and suitable research solvent such as bacteriostatic water (BAC), which may help support handling stability and reduce contamination risk.

For convenient laboratory use, see Bacteriostatic water 10ml.

Find out what benefits peptides have

Discover how peptides can boost recovery, improve skin health, increase energy and support overall performance. Explained simply and clearly in this short video.

Why Limitless Biochem?

Limitless BioChem is a trusted supplier of research compounds. Our products meet strict quality standards and are compliant with EU requirements. We focus on the safe and reliable supply of peptides and pure compounds intended exclusively for research or collector purposes.

This product is not intended for human or veterinary use. It is for collection or research purposes only. It cannot be used as food, dietary supplement or medicine! The information provided in the text on this page is for educational purposes only and does not constitute medical or other advice.

RELATED PRODUCTS

Scroll to Top
Cart • 0
You're 500.00 away from FREE Shipping!
FREE
Shipping

Your cart is empty

AI
Limitless AI help Choose question type

How can I help you?