Your cart is empty
- 15 000+ Verified Orders!
EGF 650 mcg
299.00€
Availability: 98 in stock
- Third Party Tested
- 14-Day Money Back Guarantee
- Fast Delivery Worldwide
EGF 650 mcg research-grade lyophilized protein powder supplied in a glass vial. Epidermal growth factor (EGF) is a signaling protein commonly studied in laboratory models involving EGFR activation, intracellular signaling, cellular proliferation, migration and differentiation.
All products are intended exclusively for laboratory and scientific research. Not for human or veterinary use.
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Laboratory handling conditions should follow the product-specific Certificate of Analysis and validated experimental protocol.
Select the appropriate sterile research diluent according to the requirements of the intended in vitro or laboratory workflow.
Research Overview
Epidermal growth factor is a signaling protein studied primarily for its interaction with the epidermal growth factor receptor (EGFR). Binding of EGF to EGFR is used in laboratory models to investigate receptor activation, intracellular signal transduction and subsequent changes in cellular behavior.
Primary Research Areas
- EGFR signaling: Laboratory studies examining receptor binding, receptor phosphorylation and downstream signaling pathways activated following EGF stimulation.
- Cell proliferation: Experimental models investigating growth-factor-dependent cell-cycle activity and cellular proliferation responses.
- Cell migration: In vitro research examining cellular movement, wound-closure models and signaling mechanisms associated with migration.
- Cell differentiation: Research into changes in cellular phenotype, morphology and function following EGFR pathway activation.
Recommended solvent — Bacteriostatic water
For diluting lyophilized peptide powders, use a sterile and suitable research solvent such as bacteriostatic water (BAC), which may help support handling stability and reduce contamination risk.
For convenient laboratory use, see Bacteriostatic Water – 10 ml.
Find out what benefits peptides have
Discover how peptides can boost recovery, improve skin health, increase energy and support overall performance. Explained simply and clearly in this short video.
Why Limitless Biochem?
Limitless BioChem is a trusted supplier of research compounds. Our products meet strict quality standards and are compliant with EU requirements. We focus on the safe and reliable supply of peptides and pure compounds intended exclusively for research or collector purposes.
- Peptides, Nootropics, Amino acids...
- Products tested by an independent laboratory
- Exclusively pure compounds without additives
- Worldwide Delivery
- Warning
This product is not intended for human or veterinary use. It is for collection or research purposes only. It cannot be used as food, dietary supplement or medicine! The information provided in the text on this page is for educational purposes only and does not constitute medical or other advice.