LL-37 5mg

37.45€

Availability: 87 in stock

3 Products -5%

35.58 € /pc

6 Products -10%

33.71 € /pc

8 Products -15%

31.83 € /pc

Third-Party Tested

Laboratory test for this product

View the certificate of analysis and laboratory verification for this product.

View laboratory test

LL-37 5 mg research-grade lyophilized peptide powder in a glass vial. LL-37 is the only known human cathelicidin antimicrobial peptide (hCAP18) and a key effector of the innate immune system, widely used in models of antimicrobial defense, biofilm disruption, wound healing and immunomodulation.

Research Use Only: All products are intended exclusively for laboratory and scientific research. Not for human or veterinary use.

Purity

High-purity research grade

Form

Lyophilized peptide powder

Content

5 mg LL-37 per vial

Appearance

White to off-white powder

Packaging

Glass vial with sterile closure

Storage

Store lyophilized at 2–8 °C, desiccated and protected from light

Sequence

[LL-37, 37 aa]

Molecular Formula

C₂₀₅H₃₄₀N₆₀O₅₃

Molecular Weight

≈ 4493.3 g·mol⁻¹

CAS Number

154947-66-7

In laboratory workflows, lyophilized research peptides are typically handled with suitable sterile diluents such as bacteriostatic water (BAC). For a compatible research-only solvent, see Bacteriostatic water – 10 ml .

Research Overview

LL-37 is a 37–amino-acid fragment of the human cathelicidin precursor hCAP18 and a broad-spectrum antimicrobial peptide. In experimental systems it is used as a tool compound to study innate immune defense, host–pathogen interactions, barrier function and tissue repair.

Primary Research Areas

Innate immunity & antimicrobial activity: models exploring host defense against bacteria, viruses and fungi, including membrane disruption and pathogen killing.
Biofilm disruption: in-vitro systems studying LL-37 effects on bacterial biofilms and persistence phenotypes.
Wound-healing & barrier repair: keratinocyte and epithelial models focused on re-epithelialization, migration and tissue regeneration.
Immunomodulation: investigations of chemotaxis, cytokine signaling and LL-37’s dual pro-/anti-inflammatory effects in immune-cell assays.

Find out what benefits peptides have

Discover how peptides can boost recovery, improve skin health, increase energy and support overall performance. Explained simply and clearly in this short video.

Why Limitless Biochem?

Limitless BioChem is a trusted supplier of research compounds. Our products meet strict quality standards and are compliant with EU requirements. We focus on the safe and reliable supply of peptides and pure compounds intended exclusively for research or collector purposes.

This product is not intended for human or veterinary use. It is for collection or research purposes only. It cannot be used as food, dietary supplement or medicine! The information provided in the text on this page is for educational purposes only and does not constitute medical or other advice.