All products are intended solely for collector's purposes!
It is NOT possible to use chemical substances as medicine, medicine, active substance, medical aid, cosmetic product, substance for the production of a cosmetic product...
Also not as a substance for human consumption, ie as a food or nutritional supplement or in any other similar way on humans or animals.
18+ All customers MUST be at least 18 years of age to purchase our products.

Vasoactive intestinal peptide (VIP) 10mg

107.00

Availability: 68 in stock

3 Products -5%
101.65 € /pc
6 Products -10%
96.30 € /pc
8 Products -15%
90.95 € /pc
Third-Party Tested

Laboratory test for this product

View the certificate of analysis and laboratory verification for this product.

View laboratory test

Vasoactive Intestinal Peptide (VIP) 10 mg research-grade lyophilized peptide powder in a glass vial. VIP is an endogenous neuropeptide studied in experimental models of vasodilation, smooth-muscle relaxation, pulmonary and gastrointestinal physiology, and neuroendocrine signaling.

Research Use Only: All products are intended exclusively for laboratory and scientific research. Not for human or veterinary use.

Purity
High-purity research grade

Form
Lyophilized peptide powder

Content
10 mg VIP per vial

Packaging
Glass vial with sterile closure

Storage
Store lyophilized at 2–8 °C in a dry, desiccated place, protected from light.

Molecular formula
C147H237N43O43S

Molecular weight
≈ 3323.8 g·mol⁻¹

Sequence
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 (28 aa)

CAS number
40077-57-4

Research Overview

VIP is a 28–amino acid neuropeptide used as a tool compound in vascular, pulmonary, gastrointestinal and neuroendocrine research. In experimental systems it is applied to probe VPAC1/VPAC2 receptor–mediated cAMP signaling, smooth-muscle relaxation, airway and vascular tone regulation, and broader immunomodulatory pathways in vitro and in vivo models.

Primary Research Areas

  • Vasodilation and vascular tone: Used to examine VIP receptor signaling (VPAC1/VPAC2) in regulation of vascular smooth-muscle relaxation and cAMP-dependent pathways.
  • Pulmonary physiology and airway reactivity: Studied in models of airway smooth-muscle tone, bronchodilation and inflammatory signaling in pulmonary research.
  • Gastrointestinal motility and secretion: Applied to investigate neuropeptidergic control of GI smooth-muscle motility, secretion and mucosal signaling.
  • Neuroendocrine signaling and circadian regulation: Employed in studies of hypothalamic–pituitary axes, pineal/circadian signaling and broader neuropeptidergic communication.
  • Immunomodulation and inflammatory pathways: Used in cellular models exploring VIP’s effects on cytokine profiles and immune-cell signaling networks.
Reconstitution

Recommended solvent — Bacteriostatic water

Bacteriostatic water 10ml

For diluting lyophilized peptide powders, use a sterile and suitable research solvent such as bacteriostatic water (BAC), which may help support handling stability and reduce contamination risk.

For convenient laboratory use, see Bacteriostatic water 10ml.

Find out what benefits peptides have

Discover how peptides can boost recovery, improve skin health, increase energy and support overall performance. Explained simply and clearly in this short video.

Why Limitless Biochem?

Limitless BioChem is a trusted supplier of research compounds. Our products meet strict quality standards and are compliant with EU requirements. We focus on the safe and reliable supply of peptides and pure compounds intended exclusively for research or collector purposes.

This product is not intended for human or veterinary use. It is for collection or research purposes only. It cannot be used as food, dietary supplement or medicine! The information provided in the text on this page is for educational purposes only and does not constitute medical or other advice.

RELATED PRODUCTS

Scroll to Top
Cart • 0
You're 500.00 away from FREE Shipping!
FREE
Shipping

Your cart is empty

AI
Limitless AI help Choose question type

How can I help you?